PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009596032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 527aa    MW: 58527.7 Da    PI: 8.0487
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009596032.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-1659105148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd+ l++av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
   XP_009596032.1  59 KGGWTPEEDDTLKRAVAVFRGKCWKKIAEFFP-DRSEVQCLHRWQKVL 105
                      688*****************************.************986 PP

2Myb_DNA-binding53.65.2e-17111157148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W  eEd++++++v+++G+  W+ Ia+ ++ gR +kqc++rw+++l
   XP_009596032.1 111 KGPWNREEDDKIIELVAKYGPMKWSVIAKSLP-GRIGKQCRERWHNHL 157
                      79******************99**********.*************97 PP

3Myb_DNA-binding57.23.8e-18163206146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE+  l+da++ +G++ W+ Ia+ ++ gRt++ +k++w++
   XP_009596032.1 163 KDAWTLEEERALIDAHRIHGNK-WAEIAKVLP-GRTDNAIKNHWNS 206
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.59454105IPR017930Myb domain
SuperFamilySSF466898.61E-1656115IPR009057Homeodomain-like
SMARTSM007171.0E-1458107IPR001005SANT/Myb domain
PfamPF002493.9E-1559105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2161117IPR009057Homeodomain-like
CDDcd001671.04E-1262105No hitNo description
PROSITE profilePS5129430.654106161IPR017930Myb domain
SuperFamilySSF466892.02E-30108204IPR009057Homeodomain-like
SMARTSM007174.5E-16110159IPR001005SANT/Myb domain
CDDcd001674.18E-14113157No hitNo description
PfamPF139211.2E-16114174No hitNo description
Gene3DG3DSA:1.10.10.608.3E-27118164IPR009057Homeodomain-like
PROSITE profilePS5129423.595162212IPR017930Myb domain
SMARTSM007179.7E-18162210IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-23165212IPR009057Homeodomain-like
CDDcd001671.92E-13165208No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MAELKVEDCC TENKQSAAAS NSSVSENSAS VTLRSPTVSS PTPTSPTHRR TSGPIRRAKG  60
GWTPEEDDTL KRAVAVFRGK CWKKIAEFFP DRSEVQCLHR WQKVLNPDLV KGPWNREEDD  120
KIIELVAKYG PMKWSVIAKS LPGRIGKQCR ERWHNHLNPN IKKDAWTLEE ERALIDAHRI  180
HGNKWAEIAK VLPGRTDNAI KNHWNSSLRK KLDFYLATGN LPPATRDGLQ NGCKDTTETA  240
KAEELLAASS GTADMCKIEN GWQVAEISAS NGGPQTDSTD SEVVRLEAQS PEIDAIRHIQ  300
PSTESENMYE GRRINSVVDR LKVVEAPFRC EIPACGTLYY EPPTSESCIP LDSDLLNIRW  360
AQCESDASPS PSPNGFFTPP STKSSSLYAQ TPESVLKIAA RSFPNTPSIL RKRKTQAKLS  420
TPTNKMGKSD GDFCKDKPID ACEEILPRNS SNGIGLYNSQ AFNASPPYRL RSRRTSIFKS  480
VEKQLEFTLD NEKHDISNGI SESTVNDISH AAKDCSQSAK KDTWTCP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-70582125159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-70582125159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009596032.10.0PREDICTED: myb-related protein B-like isoform X2
TrEMBLM1AHL20.0M1AHL2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000230120.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-134myb domain protein 3r-5